PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G23440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 413aa    MW: 45920.7 Da    PI: 8.7392
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G23440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.71.6e-11241201395
                      TT-EE--HHH.HTT...............---.....--SEEEEEETTS-EEEEEE..EEETTE...EEE-TTHHHHHHHHT--TT-EEEEEE- CS
               B3  13 sgrlvlpkkfaeeh...............ggkke...esktltledesgrsWevkliyrkksgr...yvltkGWkeFvkangLkegDfvvFkld 85 
                      ++rl++p +fa++                +   e   +   + +  + g++W+v+l+   ++++    +l++GW+e + a+gL eg  vv++l+
  ORUFI06G23440.1  24 LHRLSVPGEFAARLddddaagvgeeeeeeE---EsgrRAAAVLVVGPLGKVWRVELRR--SPSGdgeAWLGGGWSELAAAHGLGEGWGVVLRLE 112
                      5899*******9999999999877654432...1555677899999**********55..4444458*************************99 PP

                      SSSEE..EEE CS
               B3  86 grsefelvvk 95 
                      +r  +   ++
  ORUFI06G23440.1 113 RRGVA--SLR 120
                      87666..444 PP

2B343.55.5e-14148237397
                      EE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      k l ++d      + +p kf+++h  +  +++++  ++  + g+ W+v+l  ++ +  ++l++GW  F  a++L eg +++F+++g++ f  +v
  ORUFI06G23440.1 148 KLLQQEDL---EKMKIPEKFVQQHltETYTNNHQNAIIVCPLGKFWRVEL--QREQPDVLLRDGWAPFLAAHDLSEGNILLFRYEGNMVF--TV 234
                      55533333...3478**********944445667899999**********..999999****************************9999..66 PP

                      EEE CS
               B3  95 kvf 97 
                       vf
  ORUFI06G23440.1 235 EVF 237
                      665 PP

3B3413.5e-13322402486
                      E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
               B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                      +++++++  s +l++  +f++++g+ +++ +tl++  ++  sW+v ++ + +  +y+ + GW++F+ +n++kegD ++F  ++
  ORUFI06G23440.1 322 KEMTAYSIHS-LLSVRGTFCSQIGLLEACAITLKISMKKKGSWRVAFK-TANTYGYINGPGWRKFCLENEVKEGDCLTFNAIE 402
                      4446666655.69**********************************5.5555579***********************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.8E-1310125IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-1112127IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.4E-614125IPR003340B3 DNA binding domain
PfamPF023627.2E-925117IPR003340B3 DNA binding domain
PROSITE profilePS508639.50262125IPR003340B3 DNA binding domain
CDDcd100177.06E-1062115No hitNo description
Gene3DG3DSA:2.40.330.104.9E-21141242IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-20142246IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.294143240IPR003340B3 DNA binding domain
CDDcd100172.18E-15144237No hitNo description
SMARTSM010191.0E-6146240IPR003340B3 DNA binding domain
PfamPF023626.1E-11154237IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.4E-16317411IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-14318411IPR015300DNA-binding pseudobarrel domain
CDDcd100174.08E-7319398No hitNo description
SMARTSM010190.026320411IPR003340B3 DNA binding domain
PfamPF023624.9E-10320402IPR003340B3 DNA binding domain
PROSITE profilePS508639.601351413IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MPLSAGSLRR RPKFAAPLLS PACLHRLSVP GEFAARLDDD DAAGVGEEEE EEEESGRRAA  60
AVLVVGPLGK VWRVELRRSP SGDGEAWLGG GWSELAAAHG LGEGWGVVLR LERRGVASLR  120
VFDPGFCLAR FCTPHAGMRT KDRPHFIKLL QQEDLEKMKI PEKFVQQHLT ETYTNNHQNA  180
IIVCPLGKFW RVELQREQPD VLLRDGWAPF LAAHDLSEGN ILLFRYEGNM VFTVEVFLQN  240
GCLKEYKTAA LYLTDGTEGP SNAPQQSAAK VGVSPVKRKR TRRIEGTCLE GPNRKSRASP  300
ISVKVEPHKK HVSIVSQNSF TKEMTAYSIH SLLSVRGTFC SQIGLLEACA ITLKISMKKK  360
GSWRVAFKTA NTYGYINGPG WRKFCLENEV KEGDCLTFNA IETTVWHVVI VHC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047920.0AP004792.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0505A04.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642658.10.0PREDICTED: putative B3 domain-containing protein Os06g0632500 isoform X1
SwissprotQ67VL70.0Y6325_ORYSJ; Putative B3 domain-containing protein Os06g0632500
TrEMBLA0A0E0Q0H00.0A0A0E0Q0H0_ORYRU; Uncharacterized protein
STRINGLOC_Os06g42630.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.11e-14B3 family protein